- Epithelial Stromal Interaction 1 Antibody
- Novus Biologicals, a Bio-Techne Brand
- Pricing InfoSupplier PageView Company Product Page
- NBP1-89940
- This antibody was developed against Recombinant Protein corresponding to amino acids: ARSWAYRDSL KAEENRKLQK MKDEQHQKSE LLELKRQQQE QERAKIHQTE HRRVNNAFLD RLQGKSQPGG LEQSGGCWNM NSGNSW
- Unconjugated
- Human, Mouse
- Western Blot, Immunohistochemistry, Immunoprecipitation, Immunohistochemistry-Paraffin
- BRESI1
- 0.1 ml (also 25ul)
- PBS (pH 7.2) and 40% Glycerol
- Rabbit
- Epithelial Stromal Interaction 1
- epithelial stromal interaction 1
- Novus Biologicals, a Bio-Techne Brand
- IgG
- Polyclonal
- Immunogen affinity purified
- Primary Antibodies
- Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles
Sequence
ARSWAYRDSLKAEENRKLQKMKDEQHQKSELLELKRQQQEQERAKIHQTEHRRVNNAFLDRLQGKSQPGGLEQSGGCWNMNSGNSW
Specifications/Features
Available conjugates: Unconjugated